SKU: 16093208175

Human ApoE2 Protein, His Tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ApoE2 Protein, His TagProduct Specification Species Human Synonyms Apolipoprotein E, Apo E, APOE Accession P02649 Amino Acid Sequence Protein sequence (P02649, Lys19 His317(Arg176Cys), with C His Tag)

Product Specification


Species Human
Synonyms Apolipoprotein E, Apo-E, APOE
Accession P02649
Amino Acid Sequence

Protein sequence (P02649, Lys19-His317(Arg176Cys), with C-His Tag) KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

Expression System HEK293
Molecular Weight Predicted MW: 35.9 kDa Observed MW: 35-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, pH8.0 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

The APOE2 protein is one of three major isoforms (E2, E3, E4) of apolipoprotein E (APOE), a key lipid transport protein involved in cholesterol metabolism and neuronal repair. Encoded by the APOE gene, APOE2 differs from the most common isoform (APOE3) by a cysteine-for-arginine substitution at position 158 (Cys158Arg), altering its structure and receptor-binding affinity. While APOE2 is associated with a reduced risk of late-onset Alzheimer’s disease (AD) compared to APOE4, homozygous carriers may develop type III hyperlipoproteinemia, a lipid disorder. APOE2 exhibits weaker binding to LDL receptors, impairing clearance of triglyceride-rich lipoproteins. Its neuroprotective effects in AD may stem from enhanced amyloid-β clearance and anti-inflammatory properties.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 16093208175

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
RW
Bozeman, US
★★★★★ 4
Looks fascinating but poorly wrapped
Format: Hardcover, Format: Hardcover
This was supposed to be a Christmas gift. You would think with a book of this weight that it would have been wrapped in a thin bubble wrap to keep the dust jacket from ripping, right? Because that is what any serious book seller would have done if it had been shipped by them. But, as you can see, from the other reviews, Amazon did not do that. Keep that in mind while enjoying the low price, and consider that you might have to return it and hope for a better wrap job the second time if it’s going to be a gift. As far as content, though, it looks fascinating!!!!! The pictures, especially of the art of the period, are gorgeous. Maps and tables are super helpful. It may not be as in depth as others would prefer on each subject. However, it is a great one-stop starting point for someone who is just getting their toes wet. I have been a Bible reader/student for over twenty years, and I found something informative on each page. So unless you have a PhD in Biblical studies, I think you would find this a useful purchase and a foundational book for your library.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 17, 2022
G
Verified Purchase
Guapx
Chelsea, US
★★★★★ 5
An amazing reward at the end of the book
Format: Kindle
This is a magnificent nudge to value and form a christian word view based on the story of Gods work in the world. There is a thread that runs through the surveys of each book - all of history, past, present and future, has been compressed into Jesus, and the life that has burst from Him through his resurrection gives meaning to all things, in all places across all of time. The authors help us see this meaning in scripture and then diffuse that meaning through our lives. The final chapters offer a tremendous picture of what it looks like to live for God in Gods world - it was deeply inspiring!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 13, 2025
M
Verified Purchase
Michael E. Durham
Massapequa, US
★★★★★ 5
Great read.
Format: Hardcover
Eye opener.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 4, 2025
J
Verified Purchase
jd4nd
Waukegan, US
★★★★★ 5
Love the new flavor
Size: 1.45 Pound (Pack of 1)
I have been taking Metamucil for years but was interested in something besides the original orange. For some reason the lemon flavored option didn't seem to be as effective. This is the perfect alternative. Love the taste. I have not seen this one in stores yet. Will purchase more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2026
J
Verified Purchase
JVC
Lake Worth, US
★★★★★ 5
flavored Metamucil
Size: 1.45 Pound (Pack of 1)
unique, flavored Metamucil, but taste better than the standard orange drinklk
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026

recommand products