SKU: 2944776604

uPAR/CD87 His Tag Protein, Mouse

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

uPAR/CD87 His Tag Protein, MouseProduct Specification Species Mouse Antigen uPAR CD87 Synonyms Monocyte activation antigen Mo3, U PAR, uPAR, CD8, Urokinase Type Plasminogen Activator (UPA) Receptor, URKR, U Plasminogen Activator Receptor Form 2, CD87 Antigen, Plasminogen Activator, Urokinase Receptor, MO3 Accession P35456 Amino Acid Sequence Leu24 Gly298, with C terminal 8*His

Product Specification


Species Mouse
Antigen uPAR/CD87
Synonyms Monocyte activation antigen Mo3, U-PAR, uPAR, CD8, Urokinase-Type Plasminogen Activator (UPA) Receptor, URKR, U-Plasminogen Activator Receptor Form 2, CD87 Antigen, Plasminogen Activator, Urokinase Receptor, MO3
Accession P35456
Amino Acid Sequence

Leu24-Gly298, with C-terminal 8*His LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPTGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

45-70kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Desmedt, S. et al. (2017) Crit. Rev. Clin. Lab. Sci. 54:117.2.Smith, H. et al. (2010) Nat Rev Mol Cell Biol 11:23.

Background

Urokinase plasminogen activator surface receptor (U-PAR) is also known as PLAUR, Monocyte activation antigen Mo3, CD antigen CD87.The urokinase-type Plasminogen Activator (uPA) is one of two activators that converts the extracellular zymogen plasminogen to plasmin, a serine protease that is involved in a variety of normal and pathological processes that require cell migration and/or tissue destruction. uPA is synthesized and released from cells as a single-chain (sc) pro-enzyme with limited enzymatic activity and is converted to an active two-chain (tc) disulfide-linked active enzyme by plasmin and other specific proteinases. Both the scuPA and tcuPA bind with high-affinity to the cell surface via the glycosyl phosphatidylinositol-linked receptor uPAR which serves to localize the uPA proteolytic activity. The enzymatic activity of scuPA has also been shown to be enhanced by binding to uPAR. Independent of their proteolytic activity, the uPA/uPAR interaction also initiates signal transduction responses resulting in activation of protein tyrosine kinases, gene expression, cell adhesion, and chemotaxis. uPAR can interact with integrins to suppress normal integrin adhesive function and promote adhesion to vitronectin through a high affinity vitronectin binding site on uPAR. The uPA/uPAR interaction initiates signal transduction responses resulting in activation of protein tyrosine kinases, gene expression, cell adhesion, and chemotaxis. uPAR can interact with integrins to suppress normal integrin adhesive function and promote adhesion to vitronectin through a high affinity vitronectin binding site on uPAR. uPAR is considered as a biomarker in many inflammatory diseases including cancer, cardiovascular diseases, chronic kidney diseases and diabetes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2944776604

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
San Leandro, US
★★★★★ 1
Do not buy this junk... it will damage your car!
This junk broke my dash!!! See pictures
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 11, 2025
M
MNPJACC
Fort Morgan, US
★★★★★ 5
Perfect for every day use
The Wincar Magnetic Wireless Phone Mount and Charger is a thoughtfully designed accessory tailored for Toyota 4Runner models from 2010 to the present, and it also fits well with other vehicles using a 17mm ball mount base. The package includes a sturdy mount, a 15W magnetic wireless charger, a charging cable, and two steel rings. These steel rings are particularly useful for those who do not own a MagSafe-compatible phone or case, ensuring broader compatibility.  I specifically purchased this charger and holder to use with my existing 17mm ball mount base, which I found challenging to match with most other products—especially for my Lexus GX460. While there are many phone holders on the market, very few offer the dual functionality of both MagSafe mounting and wireless charging in one unit. This all-in-one solution eliminates the need for multiple accessories, but it’s important to note that the charger /mount  require a power connection to operate.  In terms of performance, the Wincar mount and charger deliver impressively. When connected to a reliable USB-C charging source or a USB-C cigarette lighter adapter, the magnetic grip is strong, keeping the phone securely in place even during bumpy rides. The wireless charging is efficient, providing a reasonably fast charge without overheating or lag. The magnetic force is particularly robust, ensuring that the phone remains stable and aligned for optimal charging.  Overall, this mount and charger combination offers a seamless, convenient experience for anyone seeking a reliable phone holder and charger for their vehicle. For my needs, it has proven to be both practical and effective.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 30, 2025
B
BLACK GLOVE UNBOXING
Boise, US
★★★★★ 5
A Solid Mount with Minor Imperfections
This MagSafe mount is a fantastic addition to my 2024 4Runner, offering a nearly factory-fit look. Installation was straightforward, though it required a bit of nerve. I was worried the clips attaching to the AC vent would snap, but with firm, steady pressure, they clicked securely into place without any issue. The result is a very stable platform for my phone. Functionally, it performs exactly as hoped. It supports fast charging when paired with a capable cigarette port adapter, and the magnetic connection is surprisingly strong. It holds my heavy S25 Ultra securely during daily commutes, and the inclusion of two metal rings for non-MagSafe cases is a thoughtful touch. I haven't tested its limits on a bumpy off-road trail, but for normal driving, it’s perfect. My only two critiques are minor but worth noting. With the phone in place, it completely blocks the hazard light button. A slight inconvenience. Additionally, I wish the mount's color matched the silver trim around the infotainment system for a more seamless look. Despite these small flaws, it's an excellent, clean mounting solution that I would recommend to other 4Runner owners.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 28, 2025
Z
Verified Purchase
Zach
Birmingham, US
★★★★★ 5
Five Stars — Finally Got My Charger Back!
Color: Black, Color: Black
I bought this 3-in-1 wireless charging station as a gift for my girlfriend so she would finally stop stealing mine — and let me tell you, it worked. She loves it, her devices love it, and I love not having to play “Where’s my charger?” every night like it’s some kind of relationship scavenger hunt. Pros: • MagSafe is strong — Her phone snaps on like it’s reconnecting with its soulmate. • Charges iPhone, Apple Watch, and AirPods all at once — AKA: no more tangled octopus of cables on the nightstand. • Looks clean and modern — Her side of the room instantly leveled up in aesthetics. • Fast charging — She swears her phone charges “faster than her attitude in the morning,” her words not mine. Cons: • Now she judges my setup — Apparently I’m the one with the “messy” charger now. • Might make you buy a second one — Because the moment you try to use hers, she suddenly remembers boundaries. Overall, great gift, works perfectly, and saved my sanity. Would 100% buy again — but I don’t have to, because she finally stopped borrowing mine!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 19, 2025
L
Verified Purchase
Lorraine Halderman
Louisville, US
★★★★★ 5
Fantastic charger!!
Color: Black
Bought two of these for my house due to a recommendation from my daughter. Immediately fell in love with them! They are exactly as described, very well made and look great! They’re not too big and don’t take up too much room. The magnet is VERY strong! I was worried it wouldn’t work with my phone case on, but it did! I need to mention though that I have an iPhone case specifically designed for the MagSafe technology, I do not know if it works with regular cases. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026

recommand products