SKU: 39043423522

Biotinylated LILRB3/CD85a/LIT5 Fc&Avi Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated LILRB3/CD85a/LIT5 Fc&Avi Tag Protein, HumanProduct Specification Species Human Synonyms LILRB3, CD85a, ILT5 Accession O75022 Amino Acid Sequence Gly24 Glu443, with C terminal human IgG1 Fc&Avi tag

Product Specification


Species Human
Synonyms LILRB3, CD85a, ILT5
Accession O75022
Amino Acid Sequence Gly24-Glu443, with C-terminal human IgG1 Fc&Avi tag GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE
Expression System HEK293
Molecular Weight 85-95kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Kang X. et al. (2016) Inhibitory leukocyte immunoglobulin-like receptors: Immune checkpoint proteins and tumor sustaining factors. Cell Cycle. 15(1): 25-40.

Background

LILRB3 is a member of LILRB family that is restrictively expressed on myeloid cells, including monocytes, neutrophils, eosinophils, and basophils (as well as on in vitro differentiated mast cells and osteoclasts). LILRB3 contains four cytoplasmic ITIM motifs hat may contribute to negative regulation of immune response. Ligation of LILRB3 in human myeloid cells led to inhibition of immune activation. LILRB3 may be an inhibitor of allergic inflammation and autoimmunity. However, the ligand for LILRB3 has not been identified, and the downstream signaling of LILRB3 is unclear. It is noteworthy that LILRBs, including LILRB3, are primate specific. LILRB3 is also expressed on some myeloid leukemia, B lymphoid leukemia, and myeloma cells. It is reportedly co-expressed with stem cell marker CD34 and with myeloma marker CD138.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39043423522

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Madi lohr
Dallas, US
★★★★★ 5
my new favorite book
Format: Kindle
Ok so I never write reviews but this book was so good I felt the need to write this. Firstly your introduced to Huntyr you see her closed off hard core badass than towards the end you see the most subtle change and growth it’s amazing and the enemies to friends to lovers was just perfect, AND THE TWIST AT THE END GOT ME GOOD! You see one spicy scene the whole book but it doesn’t even MATTER BECAUSE THE BOOK WAS THAT GOOD. I’ve read 85 books in 2023-2024 so far and I’m pround to say this is my all time favorite. I’m so excited to read more of Emily Blackwoods books, this was my first time reading one of hers and I’m glad I did because HOLY!! Well done Emily well done
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2024
R
Verified Purchase
Robin
Lowell, US
★★★★★ 4
Fast paced romantasy you will not want to put down!
Format: Kindle
4.25 stars! I LOVED this book with similar vibes to Hush Hush, Fourth Wing, and The Serpent and the Wings of Night! It was fast paced with easy world building and will keep you turning the pages late into the night because you will not want to put it down! Huntyr is a fierce bad@ss FMC trained to kill vampyres her entire life. She is sent on a mission to go to the academy and earn her spot into The Golden City. Upon arrival, she is forced to room with the delicious fallen angel, Wolf, who is the only one who knows about her assassin identity. The romance, the plot twists, the secrets revealed, the battles, and the tantalizing training scenes had me hooked! And that ending…. I’m holding my breath in need to know hell! Read if you love: 🪽 Fae, Vampyres, Fallen Angels 🪽 Academy setting with magical trials 🪽 Forced proximity and slow burn 🪽 Rivals to lovers 🪽 Hidden identities and secrets 🪽 Tend your wounds “𝘖𝘧 𝘤𝘰𝘶𝘳𝘴𝘦 𝘐 𝘸𝘢𝘴 𝘸𝘢𝘵𝘤𝘩𝘪𝘯𝘨 𝘺𝘰𝘶. 𝘐 𝘤𝘰𝘶𝘭𝘥𝘯’𝘵 𝘭𝘰𝘰𝘬 𝘢𝘸𝘢𝘺 𝘧𝘰𝘳 𝘢 𝘮𝘰𝘮𝘦𝘯𝘵, 𝘦𝘷𝘦𝘯 𝘪𝘧 𝘐 𝘵𝘳𝘪𝘦𝘥.” “𝘐𝘧 𝘺𝘰𝘶 𝘸𝘢𝘯𝘵 𝘮𝘦 𝘰𝘯 𝘮𝘺 𝘬𝘯𝘦𝘦𝘴, 𝘏𝘶𝘯𝘵𝘳𝘦𝘴𝘴, 𝘢𝘭𝘭 𝘺𝘰𝘶 𝘩𝘢𝘷𝘦 𝘵𝘰 𝘥𝘰 𝘪𝘴 𝘢𝘴𝘬.” “𝘠𝘰𝘶 𝘥𝘰 𝘯𝘰𝘵 𝘬𝘯𝘰𝘸 𝘵𝘩𝘦 𝘷𝘪𝘰𝘭𝘦𝘯𝘤𝘦 𝘵𝘩𝘢𝘵 𝘳𝘶𝘯𝘴 𝘵𝘩𝘳𝘰𝘶𝘨𝘩 𝘮𝘺 𝘷𝘦𝘪𝘯𝘴, 𝘣𝘦𝘨𝘨𝘪𝘯𝘨 𝘮𝘦 𝘵𝘰 𝘰𝘣𝘭𝘪𝘵𝘦𝘳𝘢𝘵𝘦 𝘢𝘯𝘺𝘰𝘯𝘦 𝘸𝘩𝘰 𝘭𝘢𝘺𝘴 𝘢 𝘩𝘢𝘯𝘥 𝘰𝘯 𝘺𝘰𝘶.”
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 12, 2024
B
Verified Purchase
Bernadette Smith
Phoenix, US
★★★★★ 5
Excellent Rivals to Lovers!!
Format: Kindle
The tension and banter between Huntyr and Wold was delectable. I absolutely love the fallen angel and all of his flaws. Huntyr is amazing too being a badass FMC with some major trauma. The world building was great and I enjoyed the training aspect of the story. The writing was immersive and was in the story the whole time. The ending had quite a twist that I hadn’t anticipated and made my jaw DROP. Excellent job! I also loved the narration. Laura is one of my fave narrators!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 15, 2025
J
Verified Purchase
Jeff Gomske
Boise, US
★★★★★ 5
Astonishing, Fun, Entertaining, Fantastic
Format: Kindle
I consider The Martian my favorite fictional novel of the last 15-20 years. The movie was incredible in that they actually followed the book closer than 99% of other films based on books. It remains my favorite movie of the last 15 years or so as well. I don't know anyone (personally) that loves either of them as much as I do. With that said, I was REALLY looking forward to Artemis. It was good...but, it was certainly not in the same caliber as The Martian was (at least not for me). I enjoyed it a lot, however and appreciated how author Andy Weir chose to go in a completely different direction and not just rehash another similar story, which I am certain would have been great as well. As a result, I was cautious regarding Project Hail Mary. It sounded a little too close to The Martian, but yet, also different in that the circumstances simply could not be more opposite and the stakes so much higher. I'm trying to figure out the best way to summarize without giving too much away from this utterly compelling novel. As I read several reviews, I noticed a recurring theme: SCIENCE. Lots and LOTS of science. Holy cow, they were right. Many years ago I read Apollo 13 and Jim Lovell and his co-writer, try as they might, simply could not dumb down Orbital Mechanics anywhere near enough for me to have even a minor clue as to what they were attempting to say...I just skipped 90% of it and hoped that the sentences written afterwards, would help to make sense of what I had just skimmed over. I'm a lot of things, but a math wizard is definitely not one of them. Michael Crichton (Jurassic Park) had an amazing talent for dumbing-down the science of what he was trying to explain in ways that genuinely made sense (most of the time). Not everyone has this talent, and I would say Andy Weir falls squarely in between. He's certainly better than Jim Lovell, but not quite as good as Crichton. But then again, outside of a science textbook, I haven't really read anything with quite as MUCH science as Project Hail Mary. So maybe he's just as good, but he just puts more science into his books than Crichton, maybe that's it...? Either way, be prepared for a lot of astonishingly interesting science within the pages of this novel...and I DO mean a LOT. I don't say this to make you wary or steer you away...on the contrary, Andy Weir has a special talent for making hard science truly entertaining. The book opens with an absolutely amazing and frightening premise: an astronaut awakes from an induced coma to find the only other two people on board have died at some point along their journey...but it gets worse. He has no idea who he is, or why he's on the ship, and oh yeah, they look to be a long way from home. A really, REALLY long way from home. In fact, the sun he sees isn't actually OUR sun at all. He's managed to leave our solar system entirely. And he has no idea why. ((Minor Spoilers)) The book goes through some clever flash-backs, which set the stage for why the mission happens, and slowly, carefully explains how they managed to get so far away from earth in such a short amount of time. Basically, earth's sun seems to be dying. At the rate of decay, we have maybe 19 years left before the gradual cooling has catastrophic consequences resulting in the death of billions (best guess). Why the sun is dimming is quite the conundrum in the first place. Turns out it really isn't dying, it's being killed by an outside source...which turns out to be easily the greatest find in history. It's alien life, and they are using the sun for food, essentially. It's alien life, but not intelligent life. But still, wow! ALIENS, right??? After this monumental discovery, and some tremendous research done by the most improbable scientist, the investigation into what is happening and why and what to do about it expands exponentially to other nations in order to pool all the resources possible to hopefully save the sun, and by extension, the human race as well. They learn. A LOT. A plan is put together, and with the help of the newly discovered microscopic alien life, which can also double as a power source (along with a few other nifty surprises), they begin to create one last, Hail Mary that could very well be the last chance we might have to save earth. It's audacious. It's dangerous, and it is absolutely critical that it succeed. As our astronaut's memory slowly unravels, so does his identity: Ryland Grace. He's a teacher on earth. Just a science teacher. Not even a college professor. He's amazingly smart, though. But he's no astronaut...and certainly not one who would volunteer to go on a one-way mission to another solar system to "try" and save humanity. Yet here he is. Alone. light years from earth, trying to solve the biggest riddle in all of human history. Ryland accepts his situation, such as it is, with relative indifference (for the most part). It doesn't matter HOW he got here. He's here now and he may as well use that time to be as productive as possible, right? Along the way, he unravels even more information regarding the microscopic alien life which is slowly dimming our sun during some additional flashbacks. The aliens, dubbed, "Astrophage" are quite the galactic plague as it turns out. Stars all over the galaxy are also losing their light, all due to the little buggers. All that is, except one particular star named, Tau Ceti. Now why would that one star be unaffected by Astrophage, when every single star around it has been affected to some degree. The plan is to go there and figure it out and send the information back, hopefully in time to save the sun before the damage to earth is beyond repair. There is an incredible amount of stuff going on. The story switches from Tau Ceti to flashbacks of how the whole mission was planned and implemented (which is VERY entertaining, especially Director Stratt, who may actually be my favorite character in the entire novel). Weir is becoming quite adept at building tension, and abruptly switching the story from Tau Ceti back to earth and building more of the backstory then switching back to Tau Ceti. Keeping it all in check and most importantly, interesting all while mixing in a healthy dose of science, which I am to understand is pretty much all genuine, is quite the juggling act. I have long known science can be astronomically entertaining (see what I did there?) when done right...but unfortunately very few people in a position to teach science actually know the best way to create that interest in others. I can say without reservation, Andy Weir definitely knows how to do it...at least in written form. There is so much I want to say more regarding this truly phenomenal story, but I simply cannot without ruining a lot of the fun and surprises revealed along the way...and it is killing me to keep it locked in. Though I labeled a spoiler warning earlier, I don't think it gave away any more than what the author himself has revealed in interviews he has done regarding the book, and what you can glean from reading the summary here and just a couple other reviews. Tying all of that science together is truly astonishing to me. The creativity to put it into a novel that is remarkably exciting to read is nothing more than incredible talent. Kudo's to Andy Weir for not just hitting a home run, Project Hail Mary is a Grand Slam all the way. I truly did not want this story to end. By the way, I enjoyed the ending quite a bit. I don't know if everyone will. But it was fine for me. I think the ending screams "sequel" at some point too. A lot was left open-ended (IMO) and I wouldn't mind reading a follow-up to this. It doesn't HAVE to happen, but there are a lot of ways where the story could go if Andy chose to do it. Just sayin'. Just run out and buy this book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2021
M
Verified Purchase
Mahlon Everhart
Charlottesville, US
★★★★★ 5
Wonderful
Format: Kindle
The amount of detail in this book is so interesting and the specifics of so much theoretical ideas revolving around true ideas makes it so fun to read. The writer does a great job and describing every situation enough where you get the point but not too much to try to bore you . The book is very easy to follow, keeps you on your toes, was pretty funny to me, and truthfully just a great book for anyone!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026

recommand products