SKU: 43811945486

CD155/PVR His Tag Protein, Mouse

Sale price$220.50 Regular price$245.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD155/PVR His Tag Protein, MouseProduct Specification Species Mouse Synonyms FLJ25946, PVS, TAGE4, HVED, NECL5 Accession Q8K094 Amino Acid Sequence Asp29 Leu348, with C terminal 8*His

Product Specification


Species Mouse
Synonyms FLJ25946, PVS, TAGE4, HVED, NECL5
Accession Q8K094
Amino Acid Sequence

Asp29-Leu348, with C-terminal 8*His DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHLGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 50-70kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Liu Lu ,Wang Ying ,Geng Chen,Wang Aihong ,Han Sai ,You Xuewu ,Sun Yu ,Zhang Junhua ,Lu Wei ,Zhang Youzhong. CD155 Promotes the Progression of Cervical Cancer Cells Through AKT/mTOR and NF-kappa B Pathways. [J] FRONTIERS IN ONCOLOGY.2021-07-05(11).

Background

CD155 is a member of the immunoglobulin superfamily also known as the human receptor for poliovirus (PVR). The full length (or PVR alpha isoform) is synthesized as a 417 amino acid (aa) precursor that contains a 20aa signal sequence, a 323aa extracellular region, a 24aa TM segment and a 50aa cytoplasmic tail. It has been demonstrated that CD155 can be recognized and bond by DNAM-1 and CD96 which promote the adhesion, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity. CD155 is expressed at high levels in several human malignancies and seems to have pro tumorigenic and therapeutically attractive properties that are currently being investigated in the field of recombinant oncolytic viro therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43811945486

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 1209 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
ShariC
Boise, US
★★★★★ 5
A Helpful Map for First-Time Astral Travelers
Format: Kindle
I picked up this book because I wanted to learn what “astral projection” really means. The author writes in clear steps that I can follow like relax your body, calm your mind, picture a gentle rope, and imagine climbing out. The ideas sound strange at first, but the explanations make them feel safe. The “what if” chapter answers simple questions like, What if I get scared? How do I get back? The author says you can return any time by thinking about your body, which makes me feel less nervous. I also liked the short stories about other people’s trips which they show that each experience is different. I haven’t left my body yet, but I have felt a light floaty feeling while practicing the breathing exercise. That small success keeps me excited to try again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2025
J
Verified Purchase
James Field
Cuba, US
★★★★★ 5
A Guiding Light for Aspiring Astral Travelers
Format: Kindle
I've been fascinated by astral travel since I was a young man—back in my day, we called it Transcendental Meditation—and I've tried countless methods, only to doze off! However, Astral Projection for Beginners: Guide to Mastering Astral Travel & Out-Of-Body Experiences for Optimal Living by Sophia Grace has truly rekindled my interest. This book presents a wealth of practical advice and easy-to-follow techniques that make the mysterious art of astral projection seem possible and achievable. Sophia Grace skillfully breaks down complex concepts into bite-sized, accessible steps, allowing even sceptics like me to understand the process without getting lost in technical jargon. The author also delves into the benefits of exploring life beyond our physical realm, emphasising the power of positive thought and disciplined meditation. While I still fall asleep sometimes, the book's clear guidance and refreshing perspective give me renewed hope—and plenty of reasons to keep trying. Whether you're a seasoned spiritual explorer or a curious beginner, this guide is a fantastic resource. If nothing else, it's a great way to drift off into a peaceful slumber!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2025
R
Rothkra
Port Orchard, US
★★★★★ 4
Interesting book, well written
Format: Kindle
I read this more out of curiosity than anything else, but the book is well written and provides a lot of good information.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2025
H
Verified Purchase
Hailey Puka
Omaha, US
★★★★★ 5
This book is great!
Format: Hardcover
I bought this for a friend and it didn’t disappoint. It’s such a fun book! I’m definitely going to be borrowing it from her to make some of the recipes. The pictures are wonderful and the recipes don’t look overly complicated.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 2, 2025
M
Verified Purchase
Michelle Martin
Charlottesville, US
★★★★★ 1
Not Happy Hour
Format: Hardcover
Recipes are from Mars
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026

recommand products