SKU: 68090964206

Mouse IFN-alpha1 Protein, His Tag

Sale price$31.50 Regular price$35.00
Save 10%

Pay in installments of $8.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IFN-alpha1 Protein, His TagProduct Specification Species Mouse Synonyms Interferon alpha 1, IFN alpha 1, Ifna1 Accession P01572 Amino Acid Sequence Protein sequence (P01572, Cys24 Lys189, with C His Tag) CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK Expression System HEK293 Molecular Weight Predicted MW: 20. 8 kDa Observed MW: 20 kDa Purity 95% by SDS PAGE

Product Specification


Species Mouse
Synonyms Interferon alpha-1, IFN-alpha-1, Ifna1
Accession P01572
Amino Acid Sequence

Protein sequence (P01572, Cys24-Lys189, with C-His Tag) CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK

Expression System HEK293
Molecular Weight Predicted MW: 20.8 kDa Observed MW: 20 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interferon alpha-1 is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68090964206

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
jennabailey1272
Waukegan, US
★★★★★ 4
Decent durability
Flavor Name: Beef, Size: Small
My super chewer pit bull mix loved these! They lasted several weeks.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026
D
Verified Purchase
David
Draper, US
★★★★★ 5
Best chew toy we have ever purchased.
Flavor Name: Classic, Size: Large
My moderately active 80lb Lab - Pit mix has been steadily working on this bone for over a year. He doesnt chew it every day but he does regularly chew it for 30 or more minutes at a time. He has only been chewing on the smooth end, and the only wear it shows is a slight thinning and some grooved tooth marks. It has not had any chunks come off, and has never developed any sharp edges that make it hard to play with. It has never smelled or gotten slimy. It has never triggered resource guarding with him, but he likes it enough that presenting it to him will often get him to settle down and chew when he is in a rambunctious mood. Its size and shape allows him to hold the textured Y end with his paws while chewing on the smooth end. All in all a fantastic toy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026
L
Verified Purchase
Lindsay
Pawtucket, US
★★★★★ 5
Happy Doggo
Flavor Name: Beef, Size: Small
He immediately loved it. He doesn't take to bones quickly, but this one caught his eye. He's a 35 lb shepherd mix, and loves antlers, and chews pretty hard. I love that it doesn't smell, and havne't seen or noticed flakes. Overall would recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
H
Verified Purchase
Heather
Phoenix, US
★★★★★ 5
Excellent product, highly recommend
Flavor Name: Classic, Size: Large, Flavor Name: Classic, Size: Large
So glad I came across this brand that uses actual edible material instead of the plastic nylon! All of our dogs love the nylon chew toys, but it's so bad for them to eat the little plastic bits! I got the large one & it is VERY large! I actually wish they had a medium one, one in-between the large & small ones as an option. But our dogs still love the large one, just harder for them to carry around & boy is it loud each time it gets dropped on the hardwood floor. It's big enough both the pups can chew on it together at the same time & do just that. We've had it for a couple months now & they don't chew on it everyday, but a few times a week I'd say & it's a tad bit softer than the nylon chews, but I'd say it's held up very well!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 11, 2025
P
Verified Purchase
Patricia
Lake Worth, US
★★★★★ 4
Dogs love them
Flavor Name: Beef, Size: Small
My two pups are power chewers. These bones are great! There’s no smell and pieces don’t come off like other bones. Although I am not a fan of the sound it makes when my dogs chew on them (nails on a chalkboard sound to me) they love them and it keeps them entertained. They are extremely hard so I limit their chew time (only because I can’t afford a trip to the vet if a tooth gets cracked) overall satisfied with my purchase, both myself and pups!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 18, 2025

recommand products