SKU: 76646738536

FABP1 His Tag Protein, Human

Sale price$144.00 Regular price$160.00
Save 10%

Pay in installments of $40.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP1 His Tag Protein, HumanProduct Specification Species Human Synonyms LFABP Accession P07148 Amino Acid Sequence Met1 Ile127, with N terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAG E& RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage

Product Specification


Species Human
Synonyms LFABP
Accession P07148
Amino Acid Sequence Met1-Ile127, with N-terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity >95% by SDS-PAG E& RP-HPLC
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

FABP1 (LFABP) has been initially characterised in the liver (thus its name) but is also expressed in small intestine (duodenum and jejunum). FABP1 appears to be the most promiscuous FABP as it was reported to bind a variety of small molecules in addition to fatty acids including bile acids, lysophosphatidic acid, prostaglandins, fatty acyl-CoA, bilirubin and heme. FABP1 is a PPARα target gene. While some studies suggested that FABP1 might be involved in the delivery of ligands for PPARα activation in the nucleus, FABP1-deficient mice showed normal regulation of PPARα target genes regulation. FABP1 was reported to enhance apoB-lipoprotein secretion, which would suggest involvement of this protein in the delivery of fatty acids to the ER for esterification into lipoprotein-destined TG. Hepatic fatty acid oxidation is also diminished in fasted FABP1 knockout mice, which implies deficient transport of fatty acids to the oxidative pathway. Interestingly, no accumulation of intracellular TG accompanied attenuation of fatty acid oxidation even when the mice were challenged with a high-fat diet.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 76646738536

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
F
Verified Purchase
flash
Belleville, US
★★★★★ 5
Beloved dog toy now in glow in the dark canvas.
Style: Flying Glow Squirrel
This is a great frisbie style product with the advantage of glow in the dark visibility. My German Shepherd has been retrieving the original Chuckits for 5 years. They fly through the air and have the advantage of curved design which allows a dog to slide their mouth under it easily when it is on the ground. Awesome dog toy that my dog never tires of. Heavy duty canvas design for durability and washability when it gets muddy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
S
Verified Purchase
Stacey Dawn Brody
Los Angeles, US
★★★★★ 5
Great, tough, and will not break your dog’s teeth!
Style: Giggle Fumble
I am the aunt of several different types of dogs and they all love the giggle toys. The problem with most of them is that they are hard to Plastic (I guess so the dog doesn’t bite into the giggle box and disable it). Every pup I know is crazy about the giggle toys, but I’m always afraid they’ll break teeth. This one is very tough material but not hard so that your dog could bite down on it and enjoy the giggle.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
A
Verified Purchase
Ana M.
Draper, US
★★★★★ 5
Perfect for strong chewers!
Style: EcoFetch
Best balls for dogs who love to tear up toys. My pup tore up regular tennis balls but he can’t tear these up and he loves to just chew them. Will always buy these for our fur baby!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
B
Verified Purchase
Brittany Harman
Lake Worth, US
★★★★★ 5
Beagle’s Best Friend
Style: Super Crunch Stick, Style: Super Crunch Stick
This is my dog’s favorite toy! We’ve had it for about 6 months now. She plays with it and chews on it every single day. She takes it everywhere. Despite all her rough housing with it, it is still completely intact, so it is extremely durable! Love this thing! We call it her “crunchy carrot”
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
V
Verified Purchase
Vicki Petersen
Pawtucket, US
★★★★★ 4
Great
Style: EcoFetch
Works great and Finnley loves it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026

recommand products