SKU: 80187793754

FABP7 His Tag Protein, Human

Sale price$288.00 Regular price$320.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP7 His Tag Protein, HumanProduct Specification Species Human Synonyms Fatty acid binding protein 7 Accession O15540 Amino Acid Sequence Val2 Ala132, with N terminal 8*His MHHHHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms Fatty acid binding protein 7
Accession O15540
Amino Acid Sequence Val2-Ala132, with N-terminal 8*His MHHHHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid binding protein 7 (FABP7, alternative names brain FABP (B-FABP), brain lipid-binding protein (BLBP) and mammary derived growth inhibitor-related gene (MRG)). Compared to normal brain tissue and low-grade astrocytomas, FABP7 is up-regulated in glioblastoma, and increased nuclear localization of FABP7 in glioblastoma is associated with EGFR amplification and poorer outcomes. The expression of FABP7 is also linked to enhanced cell motility and migration, with a decreasing docosahexaenoic acid (DHA, [ω-3])-arachidonic acid (AA, [ω-6]) ratio appearing to govern these effects, perturbing the normal, tightly regulated ratio of fatty acids in brain tissue and providing increased substrate for prostaglandins such as PGE2 to promote progression.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 80187793754

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 643 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
JD
Lowell, US
★★★★★ 5
Great charger, works as intended.
Color: Black
Works great, I’m able to use my Legion Go S docked to my TV with this charger whereas a 65W charger it would slowly discharge. Highly recommend for PC handheld users.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
G
Verified Purchase
GBarrington
Boise, US
★★★★★ 5
An excellent companion for my Galaxy Tab S9,
Color: Grey, Color: Grey
I'm experimenting with replacing my Windows PC with a higher end tablet. so I wanted a docking station (let's call it the DS) to connect it to a mouse, keyboard, and most i importantly, my 28 inch display screen. So Far, So Good! This review is going through the docking station, the S9, and DEX, then displayed on a nice big screen! I REALLY like using a REAL keyboard! Once it was delivered, I rushed to my workstation to see how it worked. And it didn't! Nothing, NOTHING would work. It kept telling me to check the cables. So out of frustration, I had lunch. It turned out that the case I bought for the S9 fooled me into thinking I had the DS plugged into the tablet, but it was not. Once I had figured THAT out, the docking station, and the tablet worked well together. I like that I'm using two different RF Dongles for the keyboard and mouse plugged into the DS. I don't have to use battery power to use Bluetooth for those accessories. Plus, I still have one USB 3.0 port free. The Keyboard and Mouse don't appear to lag, at all. If it does, it is so minor that I am unable to percieve it. I like that I can power the Tablet from the DS. I'm using a 20 watt Amazon charger, and it seems to work just fine. The tablet doesn't give me any messages that I'm on a slow charge and it seems to charge as it does without the DS. The only real negative is that the cable from the DS to the Tab S9 is a bit too short for the tablet to be propped upright. The tablet display remains on, and the S Pen can be used with it. I'm thinking that I might want to use the tablet itself as a sort of touchpad sometimes. I might find applications where I would want the tablet display to remain upright. I don't know, but it MIGHT be a problem, maybe. Build quality seems good. I think the DS case is metal, at least it looks and feels like aluminum. And the cord going to the Tablet seems quite robust. I can't comment yet on reliabiy, It will take some time for that info to appear. But functionally, it is everything the seller claims it is. I am satisfied. Edit: I bought one for my wife.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 8, 2024
E
Verified Purchase
Eye View
Charlottesville, US
★★★★★ 5
Awesome tool to have
Color: Grey
The UtechSmart USB C Ethernet Multiport Adapter is a great small and versatile tool. I use it to connect my Android phone or tablet to an HDMI display that is not a smart device. I primarily use it in my kids' room to watch Netflix or YouTube videos on the larger screen, or in our travel van where I have a display for the kids to watch TV while on long travels. I love this tool because it eliminates the need for DVDs, which can get scratched and the kids get tired of watching the same movies. With this tool, I can connect their device to the display, and they can watch everything together on the display and listen through my van speakers. The tool also has other great benefits that I use with my Mac, such as the ability to connect USB devices for external storage, connect to an HDMI display, or connect to Ethernet cables. This is a great tool to have in your computer bag, especially if you use a Mac or any other computer with a USB C port. Pros: Small and lightweight Versatile Easy to use Affordable Works with a variety of devices Cons: The HDMI port only supports 4K output at 30fps The Ethernet port does not support Gigabit speeds Overall: I highly recommend the UtechSmart USB C Ethernet Multiport Adapter. It is a great tool for anyone who needs to connect their devices to a variety of displays or peripherals. Overall, I am very happy with the UtechSmart USB C Ethernet Multiport Adapter. It is a great product that I would recommend to anyone.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 23, 2023
Q
Verified Purchase
Qbert888
Pawtucket, US
★★★★★ 4
Solid USB C Ethernet Hub!
Color: Grey
I was looking for an USB C Ethernet adapter for my new Samsung Galaxy book 2 Pro 360, and the first couple I ordered had the problem of constantly disconnecting and reconnecting. After some digging into the issue, it seems this has been a common problem the plagues USB C adapters, and may be due to the connection being loose, or the hub overheating, and the hub not being able to supply all the power necessary to maintain connection. So I needed a hub that had PD so that power draw would always be sufficient to maintain connection. This hub has worked as advertised, It hasn't disconnected once, and I have plugged 3 external hard drives, in addition to the Ethernet port, and getting very fast speeds, well over 400 Mbps on my 400 Mbps plan, and upload speeds are as advertised as well. So far I am very happy with the purchase, I will update this review once I have used the HDMI port. Update: 7.15.22 My laptop no longer recognizes the USB Hub. I contacted customer service to request a warranty replacement, and they shipped one out within a couple days. After sthinking about why the first hub failed, I believe it could be a heat issue. I have 3 external USB SSDs connected to the hub along with the Ethernet port, and the USB C power delivery port to provide the necessary power. I notice it gets quite warm, so I have been monitoring the heat, and placing it on a cooling pad, which keeps it from getting too hot. I wish I didn't have to use the cooling pad, but I'm pretty sure that was what led to the other hub failing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2022
A
Verified Purchase
AMC
San Leandro, US
★★★★★ 5
Works pretty well with the GPD Pocket 2 (m3-8100Y refresh)
Color: Grey
I gave this 5 stars because even though it isn't perfect, I think any issues I've encountered are more likely a result of the hardware, software, and drivers I'm using. TL;DR: It basically works as expected and I can confirm that it doesn't use DisplayLink. I contacted UTechSmart before purchase to confirm if this device used USB-C HDMI Alt-mode instead of a DisplayLink chip. They confirmed it uses the former and said that though they had not tested it with a Pocket 2, if it didn't work I could return it no questions asked. Bonus points to them for that. For reference, I'm using it with a GPD Pocket 2 (late 2018 product refresh using an Intel m3-8100Y CPU), running Windows 10 LTSC 2019 and a mixture of GPD and first-party drivers (mostly direct from Intel and Realtek). This is not how it comes from GPD, and is most definitely NOT a supported configuration by either GPD or Microsoft. I'm using the latest Intel drivers available (26.20.100.7000) from the Intel site. The only persistent issue is that on my device, if second-screen mode default (Win+P) is set to duplicate or extend then neither screen will display when the hub is first plugged in. After a few seconds one of the screens will start working again. If the default is second screen only then it will work immediately. Once external display is working, using the Win+P shortcut to switch to duplicate or extend works correctly. This is most likely a Windows or driver issue. For reference the Pocket 2 has a 1920x1200 screen that I use at 150% scaling and I mostly used 1920x1080 @100% scale monitors for testing. No HDMI adapters were used and I tested with two different known-good cables. Monitors tested were two Dell S2240L, one LG IPS234, and a Panasonic TCP50GT25. I also tested on a 4k Samsung UN50NU6950 and it reported output 4k@30fps, which is close enough to the Intel UHD 615 spec for HDMI 1.4. This hub can function without external power, but if you have problems, try connecting power before you connect it to your computer. When I used it for the first time, it wouldn't appear to work without external power, but after some unrelated software and driver updates, now it does. For me, this issue was definitely on the host side, not the hub side. The network chip is a Realtek RTL8153 USB 3 to gigabit Ethernet adapter. I own several devices that use this chip and it is serviceable, but tends to reset or drop out under sustained gigabit traffic. This is a characteristic of either the chip or Realtek's drivers, and there isn't really anything UTechSmart can do about it. (The other common providers of low cost USB->Ethernet chips (e.g. the ASIX AX88179) often have the same problems.) Below max speed, the 8153 works without any problems. As an aside, if you have one of these chips in a standalone usb adapter, you can plug it into a USB 2 port to get a trouble-free 250-350 Mb/s without having to babysit it. I haven't tried stress-testing how much power you can get from the USB 3.0 ports, nor have I tried to saturate the USB-C link with simultaneous video, network, and USB SSD file transfer traffic. It doesn't really fit my use case for the device, and if doing so didn't work or caused the hub to drop connection it wouldn't necessarily be the hub's fault anyway. One feature of the GPD Pocket 2 is that it can charge from any 5V source, not just from a USB-C PD charger. So I tried to power the hub with a regular USB power bank that can output [email protected] (Soshine E3S). When charging directly, the Pocket 2 increases current draw until the voltage begins to sag below 5V. This is normal behavior and prevents the device from pulling too much current from the charger. But when I power the hub and indirectly charge the device, the power bank's over-current protection immediately trips. For whatever reason, the hub prevents the Pocket 2 from noticing the voltage drop in time to prevent a fault. A higher output 5V source, or a proper USB-C PD power bank would probably work just fine. It's just too much for a smaller power bank. So in summary it works well, the price ($40 at time of purchase) is competitive with other similar products, and if I needed another I would start looking at UTechSmart first.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 22, 2019

recommand products