SKU: 8158002725

Human PCT(Procalcitonin), His Tag

Sale price$168.75 Regular price$187.50
Save 10%

Pay in installments of $46.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PCT(Procalcitonin), His TagProduct Specification Species Human Synonyms PCT(Procalcitonin) Accession P01258 Amino Acid Sequence Protein sequence(P01258, Ala26 Asn141 with C 10*His) MAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQ EREGSSLDSPRSKRCGNLST CMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 14. 6kDa Actual: 15kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Human
Synonyms PCT(Procalcitonin)
Accession P01258
Amino Acid Sequence

Protein sequence(P01258, Ala26-Asn141 with C-10*His)


MAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQ EREGSSLDSPRSKRCGNLST CMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANGGGGSHHHHHHHHHH 

Expression System E.coli
Molecular Weight Theoretical: 14.6kDa Actual: 15kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Procalcitonin (PCT) is a peptide precursor of the hormone calcitonin. The level of procalcitonin in the blood stream of healthy individuals is below the limit of detection (0.01 µg/L) of clinical assays. The level of procalcitonin rises in a response to a pro-inflammatory stimulus, especially of bacterial origin. Due to PCT’s variance between microbial infections and healthy individuals, it has become a marker to improve identification of bacterial infection and guide antibiotic therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 8158002725

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Birmingham, US
★★★★★ 5
100% Puppy-Approved
Flavor Name: Beef, Size: Small
My little fur baby absolutely LOVES this!! ❤️ He immediately got the zoomies when I gave it to him. 🤣 It's his new favorite chew toy and keeps him occupied for long spans of time while inside or outside of his crate. Very durable, smells pleasant, and is the perfect size for my small puppy (he is currently 10 lbs and I got him the small one). Previous chew toys that I purchased were too large/heavy for him to pick up, but this one is lightweight and perfect! I highly recommend! 🙌🏾
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
L
Verified Purchase
Lisa P T
Los Angeles, US
★★★★★ 5
Not destuctable
Flavor Name: Peanut Butter, Size: Medium
This is the first toy that none of my dogs have destroyed. It's still going strong and they love carrying it around and gnawing on it every day. The material is durable and the product is the perfect size. I will buy more soon.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
B
Verified Purchase
Bailey Rae
Birmingham, US
★★★★★ 3
It's good
Flavor Name: Beef, Size: Medium
My dog doesn't like it and he does typically like these but it is really nice quality and I like the shape and design so definitely try it because of the price
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
S
Verified Purchase
supermommy
Natrona Heights, US
★★★★★ 5
Best Dog Bone
Flavor Name: Beef, Size: Large
This is one of the best bones I've seen and I have always lived with dogs. The shape makes it so ergonomic for the dog, both of mine hold the bone down with both paws then chew the part standing up. One of my dogs was able to enjoy this while wearing a cone after surgery, supporting her natural behavior and keeping her busy. These are great for our 11 month old puppy because he was struggling to figure out how to brace the bone without it rubbing his paws, so was bracing on furniture and getting in trouble. Now he can hold the T part easily and doesn't need to use other objects he shouldn't chew by accident. They are durable, too. I got these about 2 months ago and they are barely worn with a rotty/pit/Shepard mix male puppy. If you know dogs, you know that means this is a solid durable bone! I will for sure keep these on hand for years as they are a preferred chew in my house!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
B
Verified Purchase
Baibhav Bhattarai
Grantham, US
★★★★★ 5
Doggy Delight
Flavor Name: Beef, Size: Medium
Ever felt like your dog’s chew toys are on the fritz, ending up shredded like yesterday’s sandwich? The SPOT Bam-bones PLUS T Bone is here to save the day, offering a durable and tasty solution for aggressive chewers and teething puppies alike. These bamboo fiber and nylon chews are like the super-tough treats your dog dreams of, providing hours of gnawing joy without the splintering mess. My bulldog, who treats his chew toys like they’re part of a survival game, has found his perfect match in these T Bones. The beef flavor is irresistible, making them a favorite among picky pups and ensuring they stay engaged without turning into edible confetti. The 6-inch size is perfect for keeping his jaws busy without overwhelming his mouth – a win-win for both of us. The non-splintering design is a blessing, preventing any painful encounters with broken chews and keeping our home safe from unexpected trips to the vet. Plus, the durable construction means these chews last longer than my patience during a doggy tantrum – and that’s saying something! However, the T Bones can sometimes feel like they’re too tough, requiring a bit of extra chewing to fully enjoy – turning every chew session into a mini workout for your dog’s jaws. Additionally, the price point is slightly higher than standard chews, but the durability and quality make it worth every penny. Overall, the SPOT Bam-bones PLUS T Bone is a fantastic choice for dog owners looking to provide their pets with a long-lasting and enjoyable chew experience. It’s tough, tasty, and built to withstand even the most enthusiastic chewers. A solid 5-star rating for its durability and flavor, with a tiny star lost to its occasional toughness challenges.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 23, 2024

recommand products