SKU: 82424726976

GITR/TNFRSF18 Fc Chimera Protein, Human

Sale price$250.65 Regular price$278.50
Save 10%

Pay in installments of $69.62 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GITR/TNFRSF18 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms CD357 antigen, CD357, GITR, GITR D, GITRtumor necrosis factor receptor superfamily member 18, Glucocorticoid induced TNFR related protein, TNFRSF18, tumor necrosis factor receptor superfamily, member 18 Accession Q9Y5U5 1 Amino Acid Sequence Gln26 Glu161, with C terminal Human IgG Fc

Product Specification


Species Human
Synonyms CD357 antigen, CD357, GITR, GITR-D, GITRtumor necrosis factor receptor superfamily member 18, Glucocorticoid-induced TNFR-related protein, TNFRSF18, tumor necrosis factor receptor superfamily, member 18
Accession Q9Y5U5-1
Amino Acid Sequence

Gln26-Glu161, with C-terminal Human IgG Fc QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 40-50kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1,Nature Communications volume 12, Article number: 1378 (2021) Cite this article  5809 Accesses  9 Citations  1 Altmetric  Metrics.

Background

GITR(Glucocorticoid-induced Tumor necrosis factor Receptor), also known as AITR and TNFRSF18, is a 40 kDa transmembrane glycoprotein belonging to the tumor necrosis factor receptor (TNF-R) superfamily. Mature human GITR consists of a 137 amino acid (aa) extracellular domain (ECD) with three tandem TNFR cysteine-rich repeats, a 21 aa transmembrane segment, and a 58 aa cytoplasmic domain. GITR is expressed on CD4+CD25+ regulatory T cells (Treg) as well as on subsets of thymocytes, lymph node cells, and splenocytes. GITR plays a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 82424726976

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Thomas A. Holmes
Los Angeles, US
★★★★★ 5
Fine Contemporary Poetry--Just Happens to Be Appalachian
Format: Paperback
The poems in Jesse Graves' TENNESSEE LANDSCAPE WITH BLIGHTED PINE express an indebtedness to a way of life that we contemporary Appalachians have watched transform at an accelerated pace over the past few decades, as we see the beloved old ways of our culture adapt to the demands of a society marked with the pervasiveness of media, the incursion of corporate demands, and the poignant recognition that as much as family prepares us to face the world outside our community, the impact of that world can blur the impressions our homes have made on us. Graves' work approaches these themes from various directions, as a son looking to the legacy of his family, as a youth and young man balancing education--both formal and that gleaned from personal experience--and as a family man weighing what he shares and offers in embodying those values. In this consistently fine volume, it is difficult to select favorites, but there are "River Gods," where an inebriated student and his companion cross the high railway trestle over the Tennessee River in Knoxville, Tennessee, "Deep Corner," where the speaker contemplates how his life has turned out differently than his brother's, "Mother's Milk," where the speaker weighs how much his mother has contributed to his life (including, sweetly, "an ear for slightly off-pitch singing"), and "Digging the Pond," where the speaker and his father silently acknowledge that the son will not preserve all his father's values: . . . I stood off to the side too often to learn what he was born knowing. The doing and the undoing. I can find in his face what he reads about the future in the tea-colored water, his eyes and mine trying to avoid it. Graves' love for these gifts, those accepted and those only acknowledged, resonates throughout TENNESSEE LANDSCAPE WITH BLIGHTED PINE. Graves' appreciation for lyric poetry, his talent for finding the expressiveness of everyday language, and his offering scenes with great depth of meaning and feeling make this collection memorable, worthy of high recommendation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 30, 2011
J
jwriter
Lake Worth, US
★★★★★ 5
Extraordinary Journey
Format: Paperback
Jesse Graves conducts the reader on an intimate journey from childhood to manhood. Rooted deep in the rich red clay of East Tennessee, the narrative provides fresh insights about the ties of land and family. "Johnson's Ground" describes an annual homecoming at the family cemetery: "they never let us go, even the ones/Laid under before our births continue to make their claims." The poems express both nostalgia for the past as well as forward-looking hopes for a fresh life in the future. Daughter, Chloe often becomes a bridge from present to past as in "Water Washing Away": "A fair price for the vision of a girl/ who has warped the ancient spell of time,/ who has turned back my eyes." Tennessee Landscape with Blighted Pine is an enchanting read for poet and non-poet alike.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 10, 2013
A
Verified Purchase
Austin Duck
Pawtucket, US
★★★★★ 1
Go Read Art Smith or Charles Wright
Format: Paperback
This book is clearly the case of someone steeped in a lyric tradition, but, rather than engaging in the self-reflexive structure of the tradition, is interested in describing ad nauseum, his southern experience. While there are moments in the book that tend toward the sublime, it rests largely as self-indulgent in a way antithetical to the form it chooses.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 5, 2013
A
Angels Among Us
Pawtucket, US
★★★★★ 5
Dr. G.
Format: Paperback
Jesse Graves (a.k.a. "Dr. G.") is one of my professors at East Tennessee State University. Not only is he a great teacher, he is a very talented poet. I would recommend his work to anyone! Anyone that does not like his work probably just failed his class. :p
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 25, 2014
B
Verified Purchase
Brooks Dyroff
Port Orchard, US
★★★★★ 5
Incredibly Prescient -- Touches On The Major Trends Of Our Times
Format: Hardcover
I was blown away by the fact that the author started writing this book a couple of years ago, before artificial intelligence was in the news, and before the topic and trend of loneliness became so prevalent. The clairvoyance is uncanny and the storyline, while fictional, is totally believable given what's going on in our world today. This is why the novel almost reads like nonfiction, but the plotline carries you forward like a fictional thriller. I audibly gasped, "Holy crap" during the plot twist at the end of the book. Truly a work of art, there is no doubt that this will be adapted for either a movie or a series.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2024

recommand products