Pay in installments of $70.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 22 - Jul 27
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
MUC-1(1036-1155) His Tag Protein, HumanProduct Specification Species Human Synonyms MUC 1, EMA, MCD, PEM Accession P15941 1 Amino Acid Sequence Leu1036 Gly1155, with C terminal 8*His LSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGGGGSHHHHHHHH Expression System HEK293 Molecular Weight 11 15&8kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder
Product Specification
| Species | Human |
| Synonyms | MUC-1, EMA, MCD, PEM |
| Accession | P15941-1 |
| Amino Acid Sequence | Leu1036-Gly1155, with C-terminal 8*His LSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 11-15&8kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Qing L. et al. (2022) MUC1: An emerging target in cancer treatment and diagnosis. Bull Cancer. 109(11): 1202-1216. |
Background
MUC1 is a highly glycosylated transmembrane mucin on the luminal surface of epithelial cells, protecting them from extreme factors. In cancer cells, MUC1 expression is upregulated and the protein structure, glycosylation level and spatial distribution are altered. It was found that upregulated MUC1 is involved in the regulation of several signaling pathways and plays an instrumental role in tumor cell metabolism, apoptosis, epithelial mesenchymal transition and distant metastasis. MUC1 glycosylation insufficiency leads to exposure of novel antigenic epitopes that can be used as specific targets for therapy and diagnosis. In addition, MUC1 was found to be closely related to HIF and can form a positive feedback loop leading to hypoxic malignant tumor progression. Currently, MUC1-based targeted drugs include monoclonal antibodies, antibody-coupled drugs, aptamers and cancer vaccines, some of which have already entered clinical trials.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.5 ★★★★★
Based on 20 reviews
Sort
Product Reviews
★★★★★ 5
Charles Soule's Series Continues to Impress and is Arguably the Best of Marvel's New Canon
Format: Paperback
Darth Vader leads the invasion of Mon Cala. With the Empire tightening its grip across the galaxy, Vader is dispatched by his master to the aquatic world of Mon Cala to track down a rogue Jedi who may be advising the planet's king. With the Inquisitors in tow, Vader and Grand Moff Tarkin face off with one of the first open acts of rebellion in their new Empire. Soule is at his absolute best with this series as he continues to explore a version of Vader haunted by his own inner goodness and memories of the past (the book does contain some references to events of the Clone Wars television show, but you don't need to have seen it to grasp the story). Likewise, his exploration of the seduction of the dark side is fantastic with a new Jedi target willing to use deception and war in order to light the sparks of a future rebellion. The final issue of the book may be one of the best Star Wars comics of the entire new canon with Tarkin hunting Vader for sport (on the latter's request oddly enough) across a desolate and hostile planet. The issue isn't what one expects but makes a great deal of sense when exploring the relationship between these two characters (while also explaining why Vader is so deferential to Tarkin during A New Hope). The final addition is a decent annual that sees Vader investigating the Death Star and sabotage of its construction. The annual isn't the best addition to the series (the artwork isn't up to the standards of the rest of the series), but it does introduce some intriguing ideas about Tarkin and Vader's relationship and the events that set up the Rogue One movie.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 17, 2018
★★★★★ 5
Nice
Format: Kindle
Love reading comics on the Kindle this is a great story leading up to the creation of the first death Star
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 31, 2024
★★★★★ 5
Good read
Format: Kindle
Lots of questions answered. Worked in the canon beautifully. Suggested read for every Star Wars fan. I highly recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 29, 2023
★★★★★ 5
Another superb installment in this Darth Vader series.
Format: Kindle
The series just keeps getting better and better and better. I can't wait to read the next one and the one after that and the one after that.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 5, 2022
★★★★★ 5
Great product!
Beautifull, hugable and lovable!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2026