SKU: 97036150944

Human ECP/Ribonuclease 3 Protein, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ECP/Ribonuclease 3 Protein, His TagProduct Specification Species Human Synonyms Eosinophil cationic protein, RNase 3, RNS3 Accession P12724 Amino Acid Sequence Protein sequence (P12724, Arg28 Ile160, with C His Tag) RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI Expression System HEK293 Molecular Weight Predicted MW: 17. 2 kDa Observed MW: 25 35 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation

Product Specification


Species Human
Synonyms Eosinophil cationic protein, RNase 3, RNS3
Accession P12724
Amino Acid Sequence

Protein sequence (P12724, Arg28-Ile160, with C-His Tag) RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Expression System HEK293
Molecular Weight Predicted MW: 17.2 kDa Observed MW: 25-35 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Ribonuclease 3, commonly known as Drosha, is a Class 2 ribonuclease III enzyme crucial for microRNA (miRNA) biogenesis. Located in the nucleus, it functions as the core catalytic component of the Microprocessor complex. Its primary role is to initiate miRNA processing by cleaving long primary miRNA transcripts (pri-miRNAs) into approximately 70-nucleotide precursor miRNAs (pre-miRNAs). This precise endonucleolytic cleavage is the first and essential step in the miRNA maturation pathway, which ultimately regulates gene expression post-transcriptionally. Dysregulation of Drosha is implicated in various cancers and developmental disorders.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97036150944

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kristy
Natrona Heights, US
★★★★★ 4
... into YA Westerns and I have yet to be disappointed. Under a Painted Sky is a diverse
Format: Hardcover
Over the past year I have made a foray into YA Westerns and I have yet to be disappointed. Under a Painted Sky is a diverse, cultural infused tale of two girls, Our main character, Sam a Chinese, newly orphaned girl, teams up with Annamae (Andy), an African-America, runaway slave. Together they flee St. Joe, Missouri disguised as boys and begin on the Oregon Trail. They soon join three cowboys who help keep them safe and teach them how to survive. I think what I loved most about this book is how Lee was able to incorporate Sam's Chinese heritage and beliefs along with Andy's and intertwine all it beautifully into this richly told story. Sam's and Andy's friendship was also a highlight of the book. It caused for some great moments, some funny, many heartfelt, and I was glad to see such a positive example of female friendship in a YA novel. Although "girl disguised as boy" seem to be a common theme in YA westerns I did not mind it here and thought Sam's inner thoughts about the challenges of pretending to be a boy were hilarious. I think Lee struck the perfect balance between an adventure story, a coming of age tale, and portrait of what life could be like for minorities and females in the 1800s
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 15, 2016
P
Verified Purchase
Pamela
Lake Worth, US
★★★★★ 5
A great BeeHive Award Winner!
Format: Kindle
This is a BeeHive Award winner for young adults! What a great read! It is a page turner, that's for sure. Two runaways--a slave and a Chinese girl--take to the trail West during the big Gold Rush. They meet up and join three young men traveling West to seek their fortunes. The catch? The girls are disguised as "boys!" The adventures begin! Fast paced book. Highly recommend it for young adults, but I really enjoyed it, too. Written well and in all situations, the characters were believable! I did make some predictions that, in fact, came true. Didn't ruin the story for me at all--only heightened my anticipation! Great read!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 27, 2016
A
Verified Purchase
AFSC
Port Orchard, US
★★★★★ 5
I absolutely loved everything about this story
Format: Kindle
I absolutely loved everything about this story. At first I was unsure of the time period, I've never been a huge western fan, but I'm so glad I picked this up. Not only were the historical details interesting, but the characters were timeless. Sammy was such a beautiful, courageous, complex main character, I couldn't help but root for her. The memories of her father and her connection to him through music was heartbreaking, and her heritage touched every facet of her life on the run. The family she formed with the cowboys and Andy was so genuine and real, and made me laugh in unexpected places. The action was fast paced and something was always happening, so it was hard to put down. Highly recommend this story for anyone who's a fan of adventure, strong female relationships, and romance. A++
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2015
A
Verified Purchase
Amazon Customer
Fort Morgan, US
★★★★★ 5
Stellar playbook written by a PRO! Must read for entrepreneurs investing in the STR market!
Format: Kindle
Kris's knowledge of Short term Rentals (STR's) is extensive. I have been in this market for almost four years now and there is always room for improvement. This is the best and most comprehensive STR manual I have come across during my studies. Early bird gets the worm or bookings in this completive market. Kris's playbook focuses on creating a successful STR from step A to Z. He covers pricing strategies, occupancy optimization, how to get the best guest and best ratings, managing people and feedback, operational excellence, expanding your empire, and most importantly evolving with the STR industry. I gained a wealth of knowledge from this book and have been able to incorporate important changes in how i operate my STRs. This book is worth every penny, do not hesitate, take control of your market today.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2023
M
Verified Purchase
Marcia Andreotti
Natrona Heights, US
★★★★★ 5
Very insightful for new hosts
Format: Kindle
I recently dove into the world of short-term rentals and found this book to be an indispensable guide for newcomers like myself. The author’s insightful tips and strategies have already proven to be game-changers for my rental business. The book excels in providing practical, step-by-step advice on various aspects of hosting. From setting up an inviting space to navigating the complexities of guest communication, every chapter offers actionable insights that have noticeably improved my hosting approach. Overall, this book is a must-read for anyone starting their journey in short-term rentals. It’s a comprehensive and accessible guide that imparts valuable knowledge, making it an essential resource for turning your rental venture into a thriving success. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2023

recommand products