Pay in installments of $20.49 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 2 - Aug 7
For Your Every Summer RSVP, with Code: SUMMER15
Description
motorfietshandschoen macna rigide bruinGemaakt met kwaliteitspapierfiltermateriaal in combinatie met de nieuwste in productietechnologien om maximale bescherming, prestaties en waarde te bieden
Gemaakt met kwaliteitspapierfiltermateriaal in combinatie met de nieuwste in productietechnologieën om maximale bescherming, prestaties en waarde te bieden
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 27 reviews
Sort
Product Reviews
★★★★★ 5
No white residue
Size: 3.4 Fl Oz (Pack of 1)
I put this sunscreen on immediately after it was delivered. It smells so good & goes on smoothly without any white residue. It seems to protect the skin, but then again I put some on every hour on the hour and didn't have any issues. I will be reordering. I wish this was on subscribe and save, but will continue to purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
★★★★★ 5
Best sunscreen ever
Size: 3.4 Fl Oz (Pack of 1)
I loooove this mineral sunscreen. It’s goes on so well, and works great. Definitely my favorite of all time!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
★★★★★ 5
Best mineral sunscreen
Size: 3.4 Fl Oz (Pack of 1)
Mineral sunscreen that isn’t chalky or pasty.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026
★★★★★ 1
Product leaks into the cap
Size: 3.4 Fl Oz (Pack of 1), Size: 3.4 Fl Oz (Pack of 1)
The packaging appears to be defective and potentially tampered with. Specifically, the nozzle is a different color from the rest of the tube—one that is not consistent with the brand’s standard packaging (I am familiar with this brand and have purchased it before). Additionally, the cap does not close properly, causing the product to leak into the lid and resulting in unnecessary waste.
This raises serious concerns about the product’s authenticity, quality control, and whether it may have been previously opened or altered.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
★★★★★ 5
Tried + tested on Caribbean vacation
Size: 6 Fl Oz (Pack of 1)
First let me start by saying I have an inflammatory condition so I needed a sunscreen that didn’t contribute to making my symptoms worse like many of the other sunscreens with harsh chemicals. This sunscreen is phenomenal! We just got back from a week in the Caribbean sun in Antigua/Barbuda, and I did not burn once! But there are some key things you must know before buying so that you can apply it properly and get the best protection. First, you must shake the can for about 20 seconds before each use. This way it mixes the sunscreen and applies it correctly. If you spray it and it comes out clear you have not shaken it up enough. It should spray solid white. Second, rub it in quickly after you spray it because it dries fast. Note that this does leave a white cast, but it’s not as bad as everyone says. I have light olive skin (half Hispanic, half white) and I tan easily but I also burn easily. When I applied it, it went on white but I just took the time and rub it in really well. The white cast will fade a little once it dries but it will also sit on top of the skin which is helpful to know when you need to re-apply. I applied in the morning about 20 min before getting in the sun. *Apply before putting on your swim suit! If it gets on your swimwear, it will leave white marks*. The sunscreen stayed on through pool and ocean use without rubbing off. I only needed to reapply on the tops of my shoulders once in the afternoon. Also, this is not to say that you won’t burn. While I was in the intense sun, I also spent time in the shade throughout the day just to make sure I was giving my skin breaks from the heat. But for being in the sun like I was, I am VERY impressed with this sunscreen. And for it only being spf 30, it protected me better than expected in the harsh Caribbean sun. I usually come home from vacations with a little burn but absolutely none this time! Just be sure to take time to apply it correctly and you should be good! I’d rather have a slight, minimal white cast than be burnt and miserable. It’s worth it! I’ll be using this stuff from now on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 20, 2023
recommand products
Subtil - Color Lab - Beauté Chrono - Instant 2-fase Spray - 200 ml
11.95
Romaan Black Polyester Painting Woman Small PTMD
103.00
De Wholly Hanglamp - Naturel - S
88.00
Label.M Pure Botanical Natural Nourishing Shampoo - 1000 ml- Normale shampoo - Voor Alle haartypes -
46.95
Linde Plaid Zwart Fluweel 150x200cm PTMD
163.50