SKU: 37561072081

TIGIT His Tag Protein, Mouse

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TIGIT His Tag Protein, MouseProduct Specification Species Mouse Accession NP_001139797 Amino Acid Sequence Gly26 Thr143, with C terminal 6*His GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLGGTGGGSGGGSHHHHHH Expression System HEK293 Molecular Weight 18 28kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Mouse
Accession NP_001139797
Amino Acid Sequence

Gly26-Thr143, with C-terminal 6*His GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLGGTGGGSGGGSHHHHHH

Expression System HEK293
Molecular Weight 18-28kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

T-cell immunoreceptor with Ig and ITIM domains (TIGIT), also known as VSIG9, VSTM3, and WUCAM, is a member of the poliovirus receptor family of immunoglobulin proteins. TIGIT is expressed at low levels on subsets of T cells and NK cells, and is upregulated at the protein level following activation of these cells. TIGIT marks exhausted T cells in the tumor microenvironment and during human immunodeficiency virus (HIV) infection. Research has shown TIGIT interacts with several receptors expressed on antigen presenting cells, such as dendritic cells and macrophages, as well as tumor cells and cells of the microenvironment. TIGIT binds with high affinity to PVR/CD155, and with low affinity to Nectin-2/CD112 and Nectin-3/CD113. Upon binding to its ligands, TIGIT suppresses T cell activation, and inhibits T and NK cell cytotoxicity. This inhibition can be blocked using monoclonal antibodies directed at the extracellular domain of TIGIT, resulting in rejuvenated antigen-specific CD8+ T cell responses in tumors and during HIV infection. Three potential isoforms of TIGIT have been computationally mapped.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 37561072081

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nina
Phoenix, US
★★★★★ 5
Beautiful Room Divider
Color: Black
This room divider is so beautiful and elegant yet very functional, study and very well made! I have had many compliments on its beauty and elegance. They have said it is much nicer than blurring my background. Which affects how you look on a teleconferencing meeting. I do zoom meetings at times for my religious meetings when I cannot go in person! And this is exactly what I have needed to obscure my private bedroom space. The size is perfect for my size desk. It covers completely the whole area not showing any of my bedroom to the public. When not in use I fold it up and put it away. It is lightweight and very easy to move around. The height doesn’t make it awkward to move and yet tall enough to obscure my whole background. MORE IMPORTANTLY~NO ASSEMBLY NECESSARY ‼️ You will not be at one moment disappointed by this purchase instead you will love it!💖💕💖
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2024
B
Verified Purchase
Bibiana colon
Los Angeles, US
★★★★★ 5
Medias
Size: One Size, Color: (403) Washed Navy / White / Halo Gray
Muy buenas, cómodas me encantaron
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
K
Verified Purchase
K M
Los Angeles, US
★★★★★ 5
Excellent sport sock!
Size: One Size, Color: (100) White / White / Halo Gray
Molds onto foot, super soft and breathable. A lot of my ankle socks tend to slip or cut off blood circulation. This one literally is a perfect fit. No slip. After playing hours of tennis every week, my feet don't feel sore or bruised. Must buy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 9, 2025
P
Verified Purchase
Placeholder
Houston, US
★★★★★ 5
Comfort!
Size: One Size, Color: (100) White / White / Halo Gray
Very comfortable! Thinner than the picture shows, but I like the fact that they are no show but still higher in the back and front to protect my heels and such.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 6, 2025
A
Verified Purchase
Amazon Customer
Lowell, US
★★★★★ 1
Sizing way off
Size: One Size, Color: (100) White / White / Halo Gray
These were my favorite socks, at least the old style was. They redid them and I was okay with it. However, I don't understand how they are a one size fits most. I tried them on and they were still too big at the top. There was so much extra fabric at the toes. For reference, I wear a size 8.5 women's shoe, typically. The packaging says fits most from size 5.5 to 12. I don't understand how it fits that wide range of shoe size. Definitely returning these and I will be buying something else.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 10, 2024

recommand products