SKU: 40992525259

FABP8 His Tag Protein, Human

Sale price$202.50 Regular price$225.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP8 His Tag Protein, HumanProduct Specification Species Human Synonyms Fatty acid binding protein 8, P2, PMP2 Accession P02689 Amino Acid Sequence Ser2 Val132, with N terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV Expression System E. coli Molecular Weight 18kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Human
Synonyms Fatty acid binding protein 8, P2, PMP2
Accession P02689
Amino Acid Sequence Ser2-Val132, with N-terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Expression System E.coli
Molecular Weight 18kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

FABP8 (fatty acid binding protein-8; also M [myelin]-FABP, P2 and PMP2) is also known as peripheral myelin protein 2, which is a cytosolic protein found primarily in peripheral nerves. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin. Also, PMP2 may play a role in lipid transport protein in Schwann cells. Furthermore, PMP2 may bind cholesterol. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin, which is a cytosolic protein found primarily in peripheral nerves.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 40992525259

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 1982 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jeri Kratche
Battle Creek, US
★★★★★ 5
Relevant and serious issues for today’s Christian
This is a no joke book. She takes Christianity seriously and gives her own life story and growth to encourage the reader. Very convicting read.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
C
Verified Purchase
c
Port Orchard, US
★★★★★ 5
Rosaria is an intelligent human being.
Format: Hardcover
Rosaria writes as such. She walks through lies we are told by our culture here in America and beyond. How to look at sin rightly and touches on her own experiences throughout the book. She is raw and open. However, I do think some of her definitions are not really what we use for some of it. Got me a little confused. I used it to walk my bible study through these lies. There are a lot of questions, but you get out what you put in, so I think it was well worth the time and energy it took to read, reflect and respond to the text. It has biblical backing, and I was thankful for her honesty where she has made public statements before, and has since learned more and no longer thinks that way. It has to be hard, and has been hard. To live her experiences. Such a huge cost to following Jesus. May her ministry and book sales be blessed, as this book should be in church libraries around the world. To know how to gently and lovingly interact with those who are living differently than we.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2025
J
Verified Purchase
Jeanie S
Houston, US
★★★★★ 5
Most Important book for Christians
The sincere convert accepts a complete Christ. He loves not only the reward, but the labor. He seeks not only the benefits, but the burden of Christ. He takes up the commands, yes even the cross of Christ. In contrast, the unsound and perhaps unsaved person takes Christ by halves. He is all for the salvation but not the sanctification. He is all for the privileges, but neglects the person of Christ..They desire salvation from suffering, but do not desire to be saved from sinning. Christianity is not about us being perfect but our faith in the One that is perfect. From Rosaria's perspective of being a feminist, liberal Professor, and living as a lesbian, she gave up everything for Christ. She believed the lies and found the truth that set her free. She has found meaning of the pain of what she gave up within the promises of God's word. She also understands how the lies will destroy families, communities and the only hope we have is the truth. I struggle with the difference of acceptance and approval. I believed that they were the same. They are not the same. I believed the lie and struggled because of it. Acceptance involves listening, caring for, and praying and sharing the truth of God's word. Acceptance helps you in the landmines of lies. You know the difference of the lies and the truth. Acceptance means living in the reality and not fantasy. Rosaria in great detail explains how we can love thru acceptance. Approval is not kindness and pulls us away from the reality and truth. The five lies are as follows: Homosexuality is normal Being a spiritual person is kinder than being biblical Christian Feminism is good for the world and the church Transgenderism is normal Modesty is outdated burden that serves male dominance and holds women back. These lies are the root of what keeps people from God. It is the truth that Rosaria brings forth thru her own experience, study, family, and church that is a shining light of hope. Lies do not bring hope and we need the hope of the truth that Christ testified. It is not about our feelings but the truth. We need the truth of the gospel. The gospel is not a get out of jail card but a realization that there is more. A life that is abundant in worship and awe of the God that saves. Praying that others will be blessed by this book. A special thank you to Crossway Publishing and netgalley for the aRC and the opportunity to post an honest review.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 12, 2023
S
Verified Purchase
SandiLee
Pawtucket, US
★★★★★ 5
READ IT!
Did you ever just think, "I know things are wrong, but I can't say exactly what or why?" Rosaria Butterfield makes things SOOO clear, and explains what is going wrong in our world (and how and why). READ IT!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 20, 2025
D
Verified Purchase
Daniel
Battle Creek, US
★★★★★ 4
Great help for escaping the snare of the devil (2 Tim. 2:24-26)
Format: Kindle
The five lies this book was written to expose and equip believers in Christ to dismantle were well selected. The list represents the myriad falsehoods unleashed in our present age by the liar and father of lies, the devil (Jn. 8:44). And, that our present age is anti-Christian is evident to anyone using the Bible as the rule for Christian faith and practice. In fact, the seemingly universal celebration of all who reject the created order of the two sexes—whichever way they choose—practically confirms the truth of Scripture. The false community it forms has no other unifying factor than shared rebellion against biblical authority. Like Carl Trueman, in his book The Strange New World, the author succeeds in calling for a compassionate but firm response to deceptions about human personhood. In her case, deceptions she once held dear, and by which she was once held captive. A difference is that, while Trueman’s approach is more historical and philosophical, Butterfield’s is more personal, pastoral, and Bible oriented. The testimony of her own conversion is compelling. Like the apostle Paul who became a planter of churches after having persecuted the Church, she balances her warnings against the lies with biblical exhortations of how to live-out the truth. In her chapters on modesty, she demonstrates how the internet in general, and social media in particular, have been abused to blur the distinction between what is public and what should be kept private. Her observations about narcissism, non-accountability, and exhibitionism, are worth noting. The only reason I give this book four stars instead of five is that the appendix seemed superfluous. In my opinion, the oft-quoted statement attributed to Mies Van Der Rohe (1886), “Less is More,” applies. While I believe the guidance on how to read the Bible is generally good, it seemed to promote the author’s loyalty to her denomination rather than adding anything germane to the book. It also seemed more appropriate for a pastor to teach his congregation than for a pastor’s wife to teach the Church at large. For me, it detracted from the very modesty of role that the book otherwise encouraged so well. That said, I recommend the book as a whole. The Scripture it brought to mind is Ephesians 4:14-16. As a result, we are no longer to be children, tossed here and there by waves and carried about by every wind of doctrine, by the trickery of men, by craftiness in deceitful scheming; but speaking the truth in love, we are to grow up in all aspects into Him who is the head, even Christ, from whom the whole body, being fitted and held together by what every joint supplies, according to the proper working of each individual part, causes the growth of the body for the building up of itself in love. (NASB 95).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 14, 2023

recommand products