SKU: 74463622606

CDK12/Cyclin K Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CDK12/Cyclin K ProteinProduct Specification Species Human Accession Q9NYV4 1O75909 3 Amino Acid Sequence CDK12: Q696 S1082

Product Specification


Species Human
Accession Q9NYV4-1、O75909-3
Amino Acid Sequence

CDK12: Q696-S1082

QPYKKRPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVKNS

Cyclin K:  M1-S300

MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPS

Expression System Baculovirus-InsectCells
Molecular Weight CDK12: 61.7 kDa; Cyclin K: 48.1 kDa
Purity >85% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 20 mM reduced glutathione , 1 mM DTT, 0.05% Brij35, 10% glycerol, pH 7.5
Stability & Storage

-80℃

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 74463622606

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Riley
Whiting, US
★★★★★ 5
Great thick surgery protector
Size: 20 Ft, Color: White
I am so glad there was a 20ft option. Our house is 104 years old and sockets were very scarce. I guess when we updated the electric we should have added more sockets lol I have a desktop Coca-Cola fridge and I run a desktop Vornado fan year round. So this was the perfect length to plug these 2 items in. I liked that this has a large extension cord on it. Feels very furable and that it has more meat in it yo protect my items vs the thin corded ones. It also has places to charge USB or USB C. Love the design a lot. Having the prongs turned to add from side works perfect and leaves more room for additional plugs. Very portable and no noise whatsoever.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
R
Verified Purchase
RoBo
Belleville, US
★★★★★ 5
Handy and convienent
Size: 6 Ft, Color: Black
This is a handy power strip and convenient with the USB ports for charging smaller objects with no need for adapters.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
K
Verified Purchase
Kimberly
Fort Morgan, US
★★★★★ 5
Perfect for the bathroom
Color: Dark Brown, Size: 15.7 inch, Color: Dark Brown, Size: 15.7 inch
I recently installed the these floating shelves with Wire Storage Basket, and I'm genuinely impressed with their blend of style and practicality. The shelves were easy to mount, and the included hardware felt sturdy, ensuring they're securely in place. Right off the bat, I noticed the quality of the materials; the wood has a nice finish, and the wire basket is well-constructed, promising durability. Functionality is where these shelves truly shine. The wire basket is perfect for storing smaller items, keeping them organized and within easy reach, while the shelf space is great for displaying decorative pieces. They've helped me declutter my space and add a touch of rustic charm at the same time. Aesthetically, these shelves look great in my bathroom. Overall, these floating shelves have exceeded my expectations, offering a stylish and functional storage solution that's built to last.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
L
Verified Purchase
LongTrailman
Massapequa, US
★★★★★ 5
Looks great and holds firm.
Color: Dark Brown, Size: 15.7 inch
Looks great in my bathroom. Great functionality and good quality shelving and frame. I wouldn't stack an Encyclopedia Britanica on it, but it will solidly hold bathroom items with no problem. I added a couple of motion-activated rechargeable light on each side of this unit and it really looks great while serving a very practical purpose.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
J
Verified Purchase
Jill
Phoenix, US
★★★★★ 5
Looks great
Color: Dark Brown, Size: 15.7 inch, Color: Dark Brown, Size: 15.7 inch
Ive had this shelf for 2 months now and love it! It looks grwat, was easy to put together and pretty sturdy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products