SKU: 19890979744

LOX-1/OLR1 His Tag Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LOX-1/OLR1 His Tag Protein, MouseProduct Specification Species Mouse Synonyms CLEC8A, CLEC8ASLOX1, LOXIN, OLR1, SR E1 Accession Q9EQ09 Amino Acid Sequence Arg60 Ile363, with N terminal 9*His

Product Specification


Species Mouse
Synonyms CLEC8A, CLEC8ASLOX1, LOXIN, OLR1, SR-E1
Accession Q9EQ09
Amino Acid Sequence

Arg60-Ile363, with N-terminal 9*His HHHHHHHHHRQVSDLLKQYQANLTQQDRILEGQMLAQQKAENTSQESKKELKGKIDTLTQKLNEKSKEQEELLQKNQNLQEALQRAANSSEESQRELKGKIDTITRKLDEKSKEQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKLNEKSKEQEELLQKNQNLQEALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI

Expression System HEK293
Molecular Weight 45-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Sawamura, T. et al. (1997) Nature 386:73. 

2.Daugherty, A. et al. (2000) Curr. Opin. Cardiovasc. Pulm. Ren. Invest. Drugs. 2:223. 

3.Platt, N. and S. Gordon (2001) J. Clin. Invest. 108:649. 3

4.Platt, N. and S. Gordon (1998) Chem. Biol. 5:R193.

Background

Lectin-like oxidized low-density-lipoprotein receptor-1 (LOX-1), also known as oxidized low-density-lipoprotein receptor-1 (OLR-1), is a type II transmembrane receptor belonging to the C-type lectin family. It also belongs to the functionally defined scavenger receptor (SR) superfamily, whose members share the common ability to bind and internalize modified forms of Low Density Lipoproteins (LDL). LOX-1 is the first member of the class E scavenger receptor subfamily (SR-E). It binds and supports the internalization of multiple structurally unrelated macromolecules including oxidized LDL, advanced glycation end products (AGE), activated platelets, bacteria, apoptotic or aged cells, and heat shock proteins. LOX-1 has also been implicated as an intestinal receptor involved in the transcytosis of pancreatic bile salt-dependent lipase. The human LOX-1 gene encodes a 273 amino acid (aa) residue protein with a short N-terminal intracellular domain, a transmembrane domain, an extracellular stalk/neck region followed by a C-type lectin-like domain (CTLD). The CTLD, which is required for ligand recognition, contains the six conserved cysteine residues present in all C-type lectins, but lacks the Ca2+-binding residues found in classical C-type lectins. LOX-1 can be detected on activated endothelial cells, vascular smooth muscle cells, macrophages, intestinal cells and dendritic cells. The expression of LOX-1 is induced by proinflammatory or proatherogenic stimuli, as well as by oxidized LDL itself and hemodynamic or oxidative stress. Human LOX-1 exists on the cell surface as covalent homodimers, which can further associate into non-covalent-linked oligomers. Cell surface LOX-1 can also be cleaved by yet unidentified proteases to release the soluble LOX-1 extracellular domain. Binding and endocytosis of oxidized LDL by LOX-1 induces oxidative stress, activates NF kappa B, and upregulates the expression of monocyte chemoattractant protein-1 and matrix metalloproteases. LOX-1-dependent oxidized LDL uptake also induces apoptosis by inducing the expression of the pro-apoptotic Bax and downregulation of the anti-apoptotic Bcl-2. Oxidized LDL plays a key role in the pathogenesis of atherosclerosis and endothelial dysfunction. Blockade of LOX-1 functions may turn out to be a suitable target for the therapeutic intervention of atherosclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19890979744

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 1320 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jennifer delgado
Lowell, US
★★★★★ 5
Cumplió mis expectativas
Size: 54 mm, Color: Brown/Grey/Brown Gradient
Hermosas y de buena calidad
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 26, 2025
C
Verified Purchase
Celeste
Belleville, US
★★★★★ 2
Missing “C’s” on temple
Size: One Size, Color: Cd472 Black Grey Gradient
Material felt cheap and were missing the “C’s” on both sides of the temples.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2025
A
Verified Purchase
Amazon Customer
Pawtucket, US
★★★★★ 5
Good length, nice and comfy!
Fit Type: 33" Inseam, Size: Medium, Color: Army Green
Update after wearing on international trip: I still love these pants, but something about the high waist doesn’t look great on me if I wear a shorter length or cropped top (usually what I wear with high waisted pants). The waistband is too wide, and it looks unflattering. I may try to get it altered (again) to have a thinner waistband, but not eager to spend any more on these than I already have. 😭 Original review: I love these pants….I really wanted a natural fiber pant that wasn’t ankle length (I’m 5’8”)! I do NOT like that so so so many pants (from some of my favorite name brands but especially here on Amazon also) are “high waters”. These are a tad long at 33” (they didn’t have the 31” in size M in the color I wanted), but I will get them hemmed. I am also long waisted and don’t usually like wide waistbands, but this waistband doesn’t bother me, and they look great on. They did not seem to shrink after washing, and I even put them in the dryer on low for about 10 minutes (I wasn’t brave enough to go longer), and they did not shrink much. I was hoping they might shrink a tad in length. They must run a tad large, since I am a bit heavy right now, but they aren’t too tight (like so much of my wardrobe is at the moment). They are very comfortable, and I’m glad to have some pants to wear when I travel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 23, 2025
A
Verified Purchase
Amazon Customer
Boise, US
★★★★★ 5
They are long enough. Love them.
Finally comfortable pants that fit me in length and look great. I’m buying another pair in black.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
D
Verified Purchase
dutchkirk
Los Angeles, US
★★★★★ 4
Nice!
Fit Type: 33" Inseam, Size: Medium, Color: White
Surprisingly nice. Fit is good and just a bit long. I expected shrinkage, however, after washing in cold water and drying warm, there is none that I could see. They wash nicely and don't need an iron, at least in the white version that I ordered.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026

recommand products